DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY5 and Gyc88E

DIOPT Version :9

Sequence 1:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens
Sequence 2:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster


Alignment Length:228 Identity:68/228 - (29%)
Similarity:128/228 - (56%) Gaps:26/228 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   411 TRECIQARLHSQRENQQQER-----------------LLLSVLPRHVAMEMKADINAKQEDMMFH 458
            |::.::.:|...:|.|:.::                 ||..::|:.||..::...|......|| 
  Fly   354 TQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMF- 417

Human   459 KIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCV 523
                   |:|||||:||..||.:.|:.|..|:|..||.:::.||||...|...:::.:||.|..|
  Fly   418 -------DSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVV 475

Human   524 SGLPEARADHAHCCVEMGMDMIEAISLVRE-VTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSN 587
            :|.|:..|:||....:|.:||::||:.::: .||.::.:|||:|||.|..|::||:..::.::.:
  Fly   476 AGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD 540

Human   588 DVTLANHMEAGGKAGRIHITKATLNYLNGDYEV 620
            .|..|:.||:...|.::||:::|...:..:|::
  Fly   541 TVNTASRMESTSIAMKVHISESTKVLIGPNYKI 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454 11/63 (17%)
Guanylate_cyc 460..633 CDD:306677 56/162 (35%)
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 9/49 (18%)
CYCc 383..571 CDD:214485 63/195 (32%)
Herpes_ICP4_C 794..>955 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.