DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY5 and CG10738

DIOPT Version :9

Sequence 1:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:295 Identity:89/295 - (30%)
Similarity:141/295 - (47%) Gaps:43/295 - (14%)


- Green bases have known domain annotations that are detailed below.


Human  1000 EQSPEHAT-----KVALKVVTPIIISVFVLALYLHAQQVESTA--RLDFLWKLQATEEKEEMEEL 1057
            |..|:..|     :...|.:.|.|....:..:..:|..:|:..  |.|     |..|||::.:  
  Fly   835 EDRPDFKTIRTKLRPLRKGMRPNIFDNMMAMMEKYANNLEALVDDRTD-----QLQEEKKKTD-- 892

Human  1058 QAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECL 1122
                 .|||.:||:.||.......:.:.|.|.|    |::.|:.|..|:    .:.|....::.:
  Fly   893 -----ALLHEMLPRCVADQLKKGHKVDPEHYEQ----VSIYFSDIVGFT----AMSAECTPLQVV 944

Human  1123 RLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGL---NDSTYDKVGKTHIKALADFAMKLM 1184
            ..||::...||.||..   ..:.|::|||..||..|||   |       |..|...:|..::.|:
  Fly   945 DFLNDLYTCFDSIIGH---YDVYKVETIGDAYMVVSGLPLRN-------GDLHAAEIATMSLHLL 999

Human  1185 DQMK--YINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTT 1247
            ..:.  .|.....|...::||::.|||.|||:|.:.|:|.::|:|||.||||:|:|||.:|..:.
  Fly  1000 SAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSW 1064

Human  1248 DMYQVL-AANTYQLECRGVVKVKGKGEMMTYFLNG 1281
            ...|:| ....|....|||:.:||||:..||:|.|
  Fly  1065 QCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLG 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454
Guanylate_cyc 460..633 CDD:306677
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677 66/199 (33%)
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 3/17 (18%)
TyrKc 597..847 CDD:197581 3/11 (27%)
HNOBA <862..907 CDD:285003 15/56 (27%)
CYCc 886..1078 CDD:214485 67/216 (31%)
Guanylate_cyc 913..1099 CDD:278633 67/203 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.