DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY5 and CG33958

DIOPT Version :9

Sequence 1:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens
Sequence 2:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster


Alignment Length:342 Identity:107/342 - (31%)
Similarity:177/342 - (51%) Gaps:33/342 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   951 GVTLF-DNADLLVTANAIDFF---NNGTSQWSLCENLRHRRMEAGTYFPSGVKEQSPEHATKVAL 1011
            |.||. :|.::....:||:::   ||.|....:.:....|.::  .|....:.|...:.|..:|:
  Fly   358 GTTLLKNNPNVSNERSAIEYYELMNNYTDDLRILQKALRRLIK--EYVDKTLVEADRKEAIGIAI 420

Human  1012 KVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAH 1076
            .||. :|:|..::.|      |::.|....|:.|..:::.:|::..:..:..||..:||..||..
  Fly   421 LVVV-LIVSPVIIVL------VKNAAATIQLYALNLSQKAKELKREKRKSDSLLFQMLPPSVAMQ 478

Human  1077 FLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRF 1141
            ....::...|||    |.|.:.|:.|..|:    |:.|:...:|.:..||.|...|||.|   ..
  Fly   479 LKQTQQVPAELY----EAVTIYFSDIVGFT----EIAADCTPLEVVTFLNSIYRVFDERI---EC 532

Human  1142 RQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYIN-EHSFNNF-QMKIGL 1204
            ..:.|::|||.:||.||||.    .|.|..||..:|..|:.|:|...... ..:.:.| |::.|:
  Fly   533 YDVYKVETIGDSYMVASGLP----VKNGNKHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGV 593

Human  1205 NIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVL-AANTYQLECRGVVKV 1268
            :.||||||::|.:.|:|.::|:|||.||||:|||...:|.:|.:|:..| ....::.|.||::.|
  Fly   594 HTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDV 658

Human  1269 KGKGEMMTYFL--NGGP 1283
            ||||.|.||:|  ..||
  Fly   659 KGKGLMSTYWLTCKDGP 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454
Guanylate_cyc 460..633 CDD:306677
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677 74/198 (37%)
CG33958NP_001033958.1 NIT 159..396 CDD:285564 9/37 (24%)
HNOBA <439..479 CDD:285003 10/39 (26%)
CYCc 459..647 CDD:214485 69/202 (34%)
Guanylate_cyc 485..669 CDD:278633 74/198 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.