DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AKR1C4 and CG2767

DIOPT Version :9

Sequence 1:NP_001809.4 Gene:AKR1C4 / 1109 HGNCID:387 Length:323 Species:Homo sapiens
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:325 Identity:121/325 - (37%)
Similarity:192/325 - (59%) Gaps:19/325 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    11 NDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVK 75
            |:|..|||:|.||:...:.....|::.   |:|||:||||:|.:|.||:.:|..::..:..|.||
  Fly    10 NNGEKMPVIGIGTWQASDEEIETAIDA---ALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71

Human    76 REDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLPK-DENGKVIF 139
            ||::|..:|:.....:|..|:|.::.||:.||||||||||:|.|..:...|....| |:.|.:..
  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136

Human   140 D-TVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLL 203
            | |.:.:|.|..||...:.||.||||||||:..|:..:|.  ..|.:|..||:|.|.||.|..|:
  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLV 199

Human   204 DFCKSKDIVLVAHSALGTQ-----RHKLWVDPNSPVLLEDPVLCALAKKHKQTPALIALRYQLQR 263
            |||||::|.:.|:|.||::     .....:..:.|.|::.|.:..:|..|.:|||.:.||:.:..
  Fly   200 DFCKSENITVTAYSPLGSKGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWIIDT 264

Human   264 GVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDF-----LMDHPDYPFSDEY 323
            ||..:.||.|..|:::|:.||:|:||:|::..|..|::|.|  :.||     :..||::.|.::|
  Fly   265 GVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIR--ICDFAFFHGVERHPEFTFKNQY 327

Human   324  323
              Fly   328  327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AKR1C4NP_001809.4 AKR_AKR1C1-35 6..306 CDD:381334 115/301 (38%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 113/296 (38%)
Tas 10..297 CDD:223739 111/291 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X51
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.