| Sequence 1: | NP_008966.1 | Gene: | KERA / 11081 | HGNCID: | 6309 | Length: | 352 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
| Alignment Length: | 270 | Identity: | 73/270 - (27%) |
|---|---|---|---|
| Similarity: | 130/270 - (48%) | Gaps: | 35/270 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Human 76 LYLQNNLIETIPEKPFENATQLRWINLNKNKITNYGIEKGALSQLKKLLFLFLEDNELEEVPSPL 140
Human 141 PRSLEQ---LQLARNKVSRIPQGTFSNLENLTLLDLQNNKLVDNAFQRDTFKGLKNLMQLNMAKN 202
Human 203 ALRNMPPRLPANTMQ---LFLDNNSIEGIPENYFNVIPKVAFLRLNHN---KLSDEGLPSRGFDV 261
Human 262 SSILDLQLSHNQLTKVP----RISAHLQHLHLDHNKIKSVNVSVICPSPSMLPAERDSFSYGPHL 322
Human 323 RYLRLDGNEI 332 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| KERA | NP_008966.1 | NEL | <48..>311 | CDD:330839 | 64/247 (26%) |
| LRR 1 | 72..93 | 5/16 (31%) | |||
| leucine-rich repeat | 73..96 | CDD:275380 | 6/19 (32%) | ||
| LRR 2 | 96..117 | 7/20 (35%) | |||
| leucine-rich repeat | 97..122 | CDD:275380 | 7/24 (29%) | ||
| LRR 3 | 122..142 | 5/19 (26%) | |||
| leucine-rich repeat | 123..143 | CDD:275380 | 5/19 (26%) | ||
| LRR 4 | 143..164 | 6/23 (26%) | |||
| leucine-rich repeat | 144..167 | CDD:275380 | 6/25 (24%) | ||
| LRR 5 | 167..180 | 5/12 (42%) | |||
| leucine-rich repeat | 168..193 | CDD:275380 | 8/24 (33%) | ||
| LRR 6 | 193..213 | 6/19 (32%) | |||
| leucine-rich repeat | 194..217 | CDD:275380 | 6/22 (27%) | ||
| LRR 7 | 214..235 | 4/23 (17%) | |||
| leucine-rich repeat | 218..238 | CDD:275380 | 4/19 (21%) | ||
| LRR 8 | 238..258 | 8/22 (36%) | |||
| leucine-rich repeat | 239..264 | CDD:275380 | 8/27 (30%) | ||
| LRR 9 | 263..282 | 7/22 (32%) | |||
| LRR 10 | 283..304 | 5/20 (25%) | |||
| leucine-rich repeat | 284..321 | CDD:275380 | 6/36 (17%) | ||
| leucine-rich repeat | 322..343 | CDD:275380 | 7/11 (64%) | ||
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | 3/6 (50%) | ||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | |||
| leucine-rich repeat | 113..136 | CDD:275380 | 6/19 (32%) | ||
| LRR_RI | 115..384 | CDD:238064 | 73/270 (27%) | ||
| LRR_8 | 135..195 | CDD:290566 | 18/61 (30%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 184..243 | CDD:290566 | 17/60 (28%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 8/24 (33%) | ||
| LRR_8 | 232..289 | CDD:290566 | 11/56 (20%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 280..339 | CDD:290566 | 18/62 (29%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 8/26 (31%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 7/22 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45712 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||