DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB4 and jdp

DIOPT Version :10

Sequence 1:NP_008965.2 Gene:DNAJB4 / 11080 HGNCID:14886 Length:337 Species:Homo sapiens
Sequence 2:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster


Alignment Length:92 Identity:36/92 - (39%)
Similarity:55/92 - (59%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     3 KDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNK-SPQAEEKFKEVAEAYEVLSDPKKREIYDQ 66
            :|:|.:|..::.:|.|.|:..|:..||::|||||. ..:||.||:::.||.|.|.||:||.|||:
  Fly    16 EDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDK 80

Human    67 FGEEGL----KGGAGGTDGQGGTFRYT 89
            :...|:    |...|..:..|...|||
  Fly    81 WRNSGISMSYKQWLGMKEHVGQVRRYT 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB4NP_008965.2 DnaJ_bact 4..332 CDD:274090 36/91 (40%)
jdpNP_651807.1 DnaJ 17..79 CDD:395170 27/61 (44%)

Return to query results.
Submit another query.