Sequence 1: | NP_001304028.1 | Gene: | DNAJB4 / 11080 | HGNCID: | 14886 | Length: | 337 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650328.1 | Gene: | CG3061 / 41707 | FlyBaseID: | FBgn0038195 | Length: | 370 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 66/202 - (32%) |
---|---|---|---|
Similarity: | 91/202 - (45%) | Gaps: | 40/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
Human 3 KDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQF 67
Human 68 G----EEGLKGGAGGTDGQG----GTFRYT--FHGDPHA--TFAAFFGGSNPFEIFFGRRMGGGR 120
Human 121 DSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSL-------EEIYSGCTKR 178
Human 179 MKISRKR 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DNAJB4 | NP_001304028.1 | DnaJ | 1..332 | CDD:223560 | 66/202 (33%) |
CG3061 | NP_650328.1 | DnaJ | 105..>224 | CDD:223560 | 51/118 (43%) |
DnaJ | 106..167 | CDD:278647 | 33/60 (55%) | ||
DUF1977 | 269..366 | CDD:286411 | 7/18 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |