DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB4 and CG3061

DIOPT Version :9

Sequence 1:NP_001304028.1 Gene:DNAJB4 / 11080 HGNCID:14886 Length:337 Species:Homo sapiens
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:202 Identity:66/202 - (32%)
Similarity:91/202 - (45%) Gaps:40/202 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     3 KDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQF 67
            ||||.:||:.|.|:|.:|||||:|.||:.||||||:|.|.|.||.:..|..||:|.:||:.||.:
  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169

Human    68 G----EEGLKGGAGGTDGQG----GTFRYT--FHGDPHA--TFAAFFGGSNPFEIFFGRRMGGGR 120
            |    ..|.....||..|.|    ..:.|:  |..|..|  .|..||.|..|.:....|:....:
  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQRRRQ 234

Human   121 DSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSL-------EEIYSGCTKR 178
            .:.|                    ||.....|.|....|::..:.:|:       :.:|| .|..
  Fly   235 QARE--------------------DREGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYS-LTPS 278

Human   179 MKISRKR 185
            .|.|.||
  Fly   279 HKYSVKR 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB4NP_001304028.1 DnaJ 1..332 CDD:223560 66/202 (33%)
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 51/118 (43%)
DnaJ 106..167 CDD:278647 33/60 (55%)
DUF1977 269..366 CDD:286411 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.