DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB4 and Dph4

DIOPT Version :10

Sequence 1:NP_008965.2 Gene:DNAJB4 / 11080 HGNCID:14886 Length:337 Species:Homo sapiens
Sequence 2:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster


Alignment Length:70 Identity:23/70 - (32%)
Similarity:38/70 - (54%) Gaps:8/70 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     4 DYYCILGIEKGASDEDIKKAYRKQALKFHPDK-------NKSPQAEEK-FKEVAEAYEVLSDPKK 60
            |:|.:|.:...||.::||.:|::..|:.||||       |...:|:.. |..:..|:..|.||.:
  Fly     3 DFYELLNVPSTASFDEIKCSYKQLILQCHPDKLRQLDDPNPGSEAQNSDFNAINAAWNTLKDPIR 67

Human    61 REIYD 65
            |:.||
  Fly    68 RKHYD 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB4NP_008965.2 DnaJ_bact 4..332 CDD:274090 23/70 (33%)
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 21/68 (31%)
zf-CSL <138..179 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.