DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB4 and CG14650

DIOPT Version :10

Sequence 1:NP_008965.2 Gene:DNAJB4 / 11080 HGNCID:14886 Length:337 Species:Homo sapiens
Sequence 2:NP_649473.1 Gene:CG14650 / 40566 FlyBaseID:FBgn0037252 Length:970 Species:Drosophila melanogaster


Alignment Length:65 Identity:33/65 - (50%)
Similarity:44/65 - (67%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     2 GKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQ 66
            |||.|.|||:...:|.|.|:|.|:|.|:..||||||...|||.||.:..|:|::.:|:.|.||||
  Fly   706 GKDAYSILGVPPDSSQEQIRKHYKKIAVLVHPDKNKQAGAEEAFKVLQRAFELIGEPENRLIYDQ 770

Human    67  66
              Fly   771  770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB4NP_008965.2 DnaJ_bact 4..332 CDD:274090 31/63 (49%)
CG14650NP_649473.1 DnaJ 708..769 CDD:395170 28/60 (47%)
Jiv90 800..891 CDD:464360
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.