DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB4 and CG2887

DIOPT Version :10

Sequence 1:NP_008965.2 Gene:DNAJB4 / 11080 HGNCID:14886 Length:337 Species:Homo sapiens
Sequence 2:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster


Alignment Length:51 Identity:13/51 - (25%)
Similarity:21/51 - (41%) Gaps:9/51 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     3 NSLRGEVLTLYKNL--------LYLG-RDYPKGADYFKRRLKNVFLKNKDV 44
            |.|:|..:.::.|:        .|.| |.:...|.......:|..|:|.||
  Fly    82 NQLKGPEVHVFLNIENGTKIVTTYRGHRQWRGEARPLTIEKRNSVLRNSDV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB4NP_008965.2 DnaJ_bact 4..332 CDD:274090 12/50 (24%)
CG2887NP_572633.1 DnaJ_bact 4..331 CDD:274090 13/51 (25%)

Return to query results.
Submit another query.