DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP14 and Mkp3

DIOPT Version :10

Sequence 1:NP_008957.1 Gene:DUSP14 / 11072 HGNCID:17007 Length:198 Species:Homo sapiens
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:142 Identity:45/142 - (31%)
Similarity:73/142 - (51%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    30 ITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQF------EYVKVPLADMPHAPIGL 88
            |...||||..:.:.:...|:...|..::|.|.::||    :|      :|:::|:.|.....:.:
  Fly   219 IPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPN----KFKESGDIKYLQIPITDHYSQDLAI 279

Human    89 YFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVG 153
            :|......|..........||||.||||||.|:.:||||....:.|.:|:..|:.|:|.:.||..
  Fly   280 HFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLMHTRGLSLNDAFAMVRDRKPDVSPNFH 344

Human   154 FWRQLIDYERQL 165
            |.:||:.:|.||
  Fly   345 FMQQLLSFESQL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP14NP_008957.1 DUSP14 20..169 CDD:350420 45/142 (32%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 42/136 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.