DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP14 and CG10089

DIOPT Version :9

Sequence 1:NP_008957.1 Gene:DUSP14 / 11072 HGNCID:17007 Length:198 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:173 Identity:49/173 - (28%)
Similarity:82/173 - (47%) Gaps:13/173 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    27 IAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFD 91
            :.::...|::|....:.:...|:...|:.|: |..:.|....|...|:.|..:|.|...:..||.
  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHII-AIHDSPRRLLPDKHYLCVMASDTPDQNLSQYFS 68

Human    92 TVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWR 156
            ...|.||:...:.|..|:||.||:|||.|:.:||:|...::...||...|:|.|.|..||.||..
  Fly    69 VCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQS 133

Human   157 QLIDYE-----------RQLFGKSTVKMV-QTPYGIVPDVYEK 187
            ||.::|           |:.|..|.::.: :|......|.|::
  Fly   134 QLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP14NP_008957.1 DUSP14 20..169 CDD:350420 45/152 (30%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 42/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.