DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRNP35 and SNP1

DIOPT Version :9

Sequence 1:NP_851030.1 Gene:SNRNP35 / 11066 HGNCID:30852 Length:251 Species:Homo sapiens
Sequence 2:NP_012203.1 Gene:SNP1 / 854749 SGDID:S000001323 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:66/231 - (28%)
Similarity:102/231 - (44%) Gaps:48/231 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    14 KEYDPLKAGSIDGT------------DEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQ 66
            :.|:.:|...|...            :.|||.:..                ||..|:|:.||...
Yeast    69 QRYEDIKLSKIKNAQLLDRRLQNWNPNVDPHIKDT----------------DPYRTIFIGRLPYD 117

Human    67 TKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDAD---GLVIDQHEIF 128
            ..|.:|::.|.::|:|.::|:|:|.:|..|||||||.:|:..:...|:::..   |:.|......
Yeast   118 LDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICI 182

Human   129 VDYELERTLKGWIPRRLGGGLGGKKESGQLRFGGRDRPFRKP-------INLPVVKNDLYREGKR 186
            ||.|..||:|.:.||||||||||:        |..:|..|.|       .:.|..:|...|..:|
Yeast   183 VDIERGRTVKYFKPRRLGGGLGGR--------GYSNRDSRLPGRFASASTSNPAERNYAPRLPRR 239

Human   187 ERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPT 222
            |....:.|.:| :.|.|.|..: ||.........||
Yeast   240 ETSSSAYSADR-YGSSTLDARY-RGNRPLLSAATPT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRNP35NP_851030.1 RRM_snRNP35 53..142 CDD:240683 32/91 (35%)
SNP1NP_012203.1 U1snRNP70_N 6..95 CDD:403437 3/25 (12%)
RRM_SNP1_like 89..201 CDD:410194 39/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm52920
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.