DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRNP35 and Rox8

DIOPT Version :9

Sequence 1:NP_851030.1 Gene:SNRNP35 / 11066 HGNCID:30852 Length:251 Species:Homo sapiens
Sequence 2:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:127 Identity:37/127 - (29%)
Similarity:58/127 - (45%) Gaps:21/127 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    58 LFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVI 122
            :||..|:.:.:.:.|:|.|:.:|:|...|:|||..|..||||||:.:.::.....|.:..:|..|
  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161

Human   123 DQHEIFVDYELERTLKGWIPRRL------------GGGLGGKKESGQLRFGGRDRPFRKPIN 172
            ....|       ||  .|..|:|            |||:||...:|....|.:...|.:..|
  Fly   162 GSRSI-------RT--NWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRNP35NP_851030.1 RRM_snRNP35 53..142 CDD:240683 26/83 (31%)
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 37/127 (29%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 25/81 (31%)
RRM3_TIA1_like 221..294 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.