DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRNP35 and CstF64

DIOPT Version :9

Sequence 1:NP_851030.1 Gene:SNRNP35 / 11066 HGNCID:30852 Length:251 Species:Homo sapiens
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:107 Identity:31/107 - (28%)
Similarity:56/107 - (52%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    41 LARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYK 105
            :|.....:.::...:.::||..:..:..|:||||:||..|.:..|:||.|..:|..||:.|.|||
  Fly     1 MADKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYK 65

Human   106 EERAVIKAYRDADGLVIDQHEIFVD--------YELERTLKG 139
            ::...:.|.|:.:|..|....:.||        .|:::.|:|
  Fly    66 DQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEMQQLLQG 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRNP35NP_851030.1 RRM_snRNP35 53..142 CDD:240683 30/95 (32%)
CstF64NP_477453.1 RRM <13..>112 CDD:223796 30/95 (32%)
RRM_CSTF2_CSTF2T 18..92 CDD:241115 27/73 (37%)
CSTF2_hinge 112..190 CDD:291025
CSTF_C 377..416 CDD:291002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.