DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNRNP35 and rnp-7

DIOPT Version :9

Sequence 1:NP_851030.1 Gene:SNRNP35 / 11066 HGNCID:30852 Length:251 Species:Homo sapiens
Sequence 2:NP_498565.2 Gene:rnp-7 / 176002 WormBaseID:WBGene00004390 Length:332 Species:Caenorhabditis elegans


Alignment Length:200 Identity:71/200 - (35%)
Similarity:95/200 - (47%) Gaps:51/200 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    53 DPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDA 117
            ||..||||.|:|.:|.|.||:..|..||.|::|.:|.| ..|..:|||||||.::..:..||:.|
 Worm   101 DPYRTLFVGRINYETSESKLRREFEAYGKIKKLTMVHD-EAGKPRGYAFIEYSDKAEMHTAYKKA 164

Human   118 DGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLR-----------FGGRDRPFRKPI 171
            ||:.:|...:.||||..||.|.|:|||||||.|..:::.:.:           |||         
 Worm   165 DGIKVDGKRLVVDYERGRTQKTWLPRRLGGGKGDTRKTREAKSVIEEREIASGFGG--------- 220

Human   172 NLPVVKNDLYREGKRER-RERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERD 235
                        |..:| ||||.||:|..||......:||.|.                 |....
 Worm   221 ------------GYEDRDRERSGSRDRRQDSYRNGGGNDRDRR-----------------ESSGG 256

Human   236 FRDDR 240
            |||:|
 Worm   257 FRDNR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNRNP35NP_851030.1 RRM_snRNP35 53..142 CDD:240683 41/88 (47%)
rnp-7NP_498565.2 U1snRNP70_N 4..94 CDD:371969
RRM_snRNP70 103..192 CDD:240682 41/89 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1430110at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.