Sequence 1: | NP_851030.1 | Gene: | SNRNP35 / 11066 | HGNCID: | 30852 | Length: | 251 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498565.2 | Gene: | rnp-7 / 176002 | WormBaseID: | WBGene00004390 | Length: | 332 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 71/200 - (35%) |
---|---|---|---|
Similarity: | 95/200 - (47%) | Gaps: | 51/200 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 53 DPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDA 117
Human 118 DGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKESGQLR-----------FGGRDRPFRKPI 171
Human 172 NLPVVKNDLYREGKRER-RERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDWERERD 235
Human 236 FRDDR 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SNRNP35 | NP_851030.1 | RRM_snRNP35 | 53..142 | CDD:240683 | 41/88 (47%) |
rnp-7 | NP_498565.2 | U1snRNP70_N | 4..94 | CDD:371969 | |
RRM_snRNP70 | 103..192 | CDD:240682 | 41/89 (46%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1430110at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |