DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NUDT21 and Cpsf5

DIOPT Version :9

Sequence 1:NP_008937.1 Gene:NUDT21 / 11051 HGNCID:13870 Length:227 Species:Homo sapiens
Sequence 2:NP_001036597.1 Gene:Cpsf5 / 39083 FlyBaseID:FBgn0035987 Length:237 Species:Drosophila melanogaster


Alignment Length:232 Identity:180/232 - (77%)
Similarity:197/232 - (84%) Gaps:15/232 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     7 NRSQTGWPRGVTQFG------------NKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSS 59
            |:|.:||||..:| |            .||..|.  ||:.|||||||||||||||||||:|||.|
  Fly     8 NKSGSGWPRRGSQ-GQADAASSNNNGTQKYTNQA--LTINRTINLYPLTNYTFGTKEPLFEKDPS 69

Human    60 VAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRL 124
            |.:||||||||||:|||||:|||||:||||.||||||||||||||||||||||.|||||||||||
  Fly    70 VPSRFQRMREEFDRIGMRRSVEGVLLVHEHGLPHVLLLQLGTTFFKLPGGELNAGEDEVEGLKRL 134

Human   125 MTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPK 189
            ::|.|||||||.|:|:::|.||||||||||||||||||.|||||||||:||||||.|||||||||
  Fly   135 LSETLGRQDGVKQEWIVEDTIGNWWRPNFEPPQYPYIPPHITKPKEHKRLFLVQLHEKALFAVPK 199

Human   190 NYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIY 226
            |||||||||||||||:.|||||||||||.|.||||||
  Fly   200 NYKLVAAPLFELYDNSQGYGPIISSLPQALCRFNFIY 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NUDT21NP_008937.1 Necessary for RNA-binding. /evidence=ECO:0000269|PubMed:15169763 2..147 106/151 (70%)
NUDIX_2 35..222 CDD:404710 161/186 (87%)
Necessary for interactions with PAPOLA and PABPN1. /evidence=ECO:0000269|PubMed:15169763 81..160 66/78 (85%)
Interaction with RNA. /evidence=ECO:0000269|PubMed:20479262, ECO:0000269|PubMed:21295486, ECO:0000312|PDB:3MDG, ECO:0000312|PDB:3MDI, ECO:0000312|PDB:3Q2T 102..104 1/1 (100%)
Nudix box 109..130 16/20 (80%)
Cpsf5NP_001036597.1 NUDIX_2 45..232 CDD:404710 161/186 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152562
Domainoid 1 1.000 346 1.000 Domainoid score I1047
eggNOG 1 0.900 - - E1_KOG1689
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5090
Inparanoid 1 1.050 368 1.000 Inparanoid score I2156
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54579
OrthoDB 1 1.010 - - D1194206at2759
OrthoFinder 1 1.000 - - FOG0006316
OrthoInspector 1 1.000 - - oto89982
orthoMCL 1 0.900 - - OOG6_102904
Panther 1 1.100 - - LDO PTHR13047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4023
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.