DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UPK1A and Tsp74F

DIOPT Version :9

Sequence 1:NP_001268372.1 Gene:UPK1A / 11045 HGNCID:12577 Length:273 Species:Homo sapiens
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:198 Identity:42/198 - (21%)
Similarity:79/198 - (39%) Gaps:32/198 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    20 LVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDVFAGA-WIAIFCGFSFFMVASFGVG 83
            |.:.|.:|.:.|..:|..|:|...|:..|..|:|.    ::|:|| ::.:.......:|:..|..
  Fly    18 LFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGT----NLFSGAVYVLLVTSIIICLVSFLGCV 78

Human    84 AALCRRRSMVLTYLVLMLIVYIFECASCITSYTHRDYMVSNPSLITKQMLTFYSADTDQGQELTR 148
            .|....:.::|||.:::.:|::......:..|..|:.:........:..:..|.:    .:|:|:
  Fly    79 GAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGS----RREITQ 139

Human   149 LWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCC-------RRTGNFIP----LNE 202
            .||......:|||.....||..:.            |.|..||       |:.....|    |..
  Fly   140 AWDLTQERLQCCGVDTWHDWNRYG------------PVPESCCQELFGGQRKECTIFPTITNLYN 192

Human   203 EGC 205
            :||
  Fly   193 QGC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UPK1ANP_001268372.1 uroplakin_I_like_LEL 112..216 CDD:239409 21/105 (20%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 42/198 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.