DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UPK1A and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_001268372.1 Gene:UPK1A / 11045 HGNCID:12577 Length:273 Species:Homo sapiens
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:227 Identity:46/227 - (20%)
Similarity:84/227 - (37%) Gaps:57/227 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    15 VVVGLLVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDVFAGAWIAIFCGFSFFMVAS 79
            |:.|:..:|..:::..|       .|:.........::|:...:|:  .|.:.:..|....:.:.
  Fly    14 VISGICALGGCLLIWYG-------AWLLDSLSEEQRMLGMDHGEDL--AAVLCVLLGTVIVVASI 69

Human    80 FGVGAALCRRRSMVLTYLVLMLIVYIFECASCITSY-THRDYMVSNPSLITKQMLTFYSADTDQG 143
            ||..|.....|.:::.|.||::.:.|.:......|| ..||::   |..:.              
  Fly    70 FGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFL---PDSLR-------------- 117

Human   144 QELTRLWDRVMIEQE-------------CCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCC--RR 193
            |.|..|||   ::.|             |||.:...|:::...          .| ||.||  |.
  Fly   118 QGLDDLWD---LQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEK----------MP-PPSCCLNRD 168

Human   194 TGNFIPLNEEGCRLGHMDYLFTKAGVQWHNLS 225
            ....:.|...||.:...:|:..|. ..:|:||
  Fly   169 CTKHLNLFMTGCEVKFKEYVGAKT-ANFHSLS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UPK1ANP_001268372.1 uroplakin_I_like_LEL 112..216 CDD:239409 25/119 (21%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 46/227 (20%)
tetraspanin_LEL 109..192 CDD:239401 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.