DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B4GAT1 and shams

DIOPT Version :10

Sequence 1:NP_006867.1 Gene:B4GAT1 / 11041 HGNCID:15685 Length:415 Species:Homo sapiens
Sequence 2:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster


Alignment Length:68 Identity:16/68 - (23%)
Similarity:27/68 - (39%) Gaps:19/68 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   224 LVIDVDMV---PSEGLWRGLREMLDQSNQWGGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVR 285
            |.:|.|::   |...:||..::.    |:...:||.            |.::||.:..|......
  Fly   150 LYVDTDILFLSPISDIWRFFKKF----NETQMSALT------------PEHENENIGWYNRFARH 198

Human   286 PFY 288
            |||
  Fly   199 PFY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B4GAT1NP_006867.1 Glyco_transf_49 94..409 CDD:464027 16/68 (24%)
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:472172 16/68 (24%)

Return to query results.
Submit another query.