DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIPK3 and BCK1

DIOPT Version :9

Sequence 1:NP_006862.2 Gene:RIPK3 / 11035 HGNCID:10021 Length:518 Species:Homo sapiens
Sequence 2:NP_012440.1 Gene:BCK1 / 853350 SGDID:S000003631 Length:1478 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:85/340 - (25%)
Similarity:147/340 - (43%) Gaps:55/340 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    15 LVSIEELENQ------------ELVGKGGFGTVFRAQHRKWGYDVAVKIV--------------N 53
            :|||.:.:|.            |::|||.||.|:...:...|..:|||.|              .
Yeast  1157 MVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILST 1221

Human    54 SKAISREVKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLC 118
            .:|:..||..:..||:..:::..|...|.|     ..:|..:::..||:..|::.......||:.
Yeast  1222 VEALRSEVSTLKDLDHLNIVQYLGFENKNN-----IYSLFLEYVAGGSVGSLIRMYGRFDEPLIK 1281

Human   119 RLLKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTL 183
            .|..:|:.|:.|||.:.  :||||:|..|:|||.:...|::|||:|.......|.:.. ...||:
Yeast  1282 HLTTQVLKGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDM-TMRGTV 1343

Human   184 GYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAE--LP 246
            .::|||: |:..:..|...|::|.|.::..:.||:......|.......:...::.|.:.|  ||
Yeast  1344 FWMAPEM-VDTKQGYSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLP 1407

Human   247 ---QAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVSTVKDFL--- 305
               |.|         :..:..|:...|:.||:..|.|   ...|..|....|...:.:..|:   
Yeast  1408 LISQIG---------RNFLDACFEINPEKRPTANELL---SHPFSEVNETFNFKSTRLAKFIKSN 1460

Human   306 SQLRSSNRRFSIPES 320
            .:|.||..|.:..|:
Yeast  1461 DKLNSSKLRITSQEN 1475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIPK3NP_006862.2 S_TKc 22..280 CDD:214567 72/288 (25%)
PKc_like 27..280 CDD:304357 70/271 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..443
RHIM 419..468 CDD:289491
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000269|PubMed:29681455 450..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..518
BCK1NP_012440.1 STKc_Bck1_like 1173..1440 CDD:270799 72/287 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.