DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIPK3 and slpr

DIOPT Version :9

Sequence 1:NP_006862.2 Gene:RIPK3 / 11035 HGNCID:10021 Length:518 Species:Homo sapiens
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:576 Identity:139/576 - (24%)
Similarity:218/576 - (37%) Gaps:161/576 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    16 VSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKA----------ISREVKAMASLDNE 70
            :...||:.:|::|.|||..|.|..:.  |.:||:||.:...          :.:|.|...:|.:|
  Fly   124 IEYNELDIKEVIGSGGFCKVHRGYYD--GEEVAIKIAHQTGEDDMQRMRDNVLQEAKLFWALKHE 186

Human    71 FVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRP----WPLLCRLLKEVVLGMFYL 131
            .:..|.||.      .:.|..||.::...|||:.:|..:.|..    |.:      ::..||.||
  Fly   187 NIAALRGVC------LNTKLCLVMEYARGGSLNRILAGKIPPDVLVNWAI------QIARGMNYL 239

Human   132 HDQNPV-LLHRDLKPSNVLLDPELH--------VKLADFGLSTFQGGSQSGTGSGEPGGTLGYLA 187
            |::.|: ::|||||.||||:...:.        :|:.||||:.....:|..:.:    ||..::.
  Fly   240 HNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAA----GTYAWMP 300

Human   188 PELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEP-SLVYEAVCNRQNRPSLAELPQAGPE 251
            ||: ::|: ..|..|||:|:|:|:|.::.|.......:| |:.|....|....|    :|:..||
  Fly   301 PEV-ISVS-TYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLP----IPKTCPE 359

Human   252 TPGLEGLKELMQLCWSSEPKDRPSFQECLPKTD------------EVFQMVENNMNAAVSTVKDF 304
            |.|     .||:.||.::|..||.|:|.|.:.:            |.|..::......::.|   
  Fly   360 TWG-----ALMKSCWQTDPHKRPGFKEILKQLESIACSKFTLTPQESFHYMQECWRKEIAGV--- 416

Human   305 LSQLRSSNRRFSIPESGQGGTEMDGFRRTIE-------------NQHSRNDVMVSEWLNKLNLEE 356
            |..||...:||...|......|....|...|             |...|..|::...|  :.|:.
  Fly   417 LHDLREKEKRFQTIEEELRNKEEQLLRVQNEQREKANLLKIREQNLRERERVLIEREL--VMLQP 479

Human   357 PPSSVPKKCPSLTK-----------------RSRAQEEQVP----------------QAWTAGT- 387
            .||....|.....|                 |.:|::...|                :.|...| 
  Fly   480 VPSKRKHKKGKKNKPLQISLPTGFRHTITAVRDKAEQPGSPSFSGLRIVALTDGHKGKTWGPSTM 544

Human   388 ---------SSDSMAQPPQTPETSTF----------------RNQMPSPTSTGTPSPGPRGNQGA 427
                     |..|..||....:|||.                :||....:.|..|..|..|..| 
  Fly   545 HQRERSLLPSQLSGGQPEWPAQTSTHSSFSKSAPNLDKKQQQQNQQQVASLTPPPGLGILGGSG- 608

Human   428 ERQGMNWSCRTPEPNPVTGRPLV-------NIYNCSGVQVGDNNYLTMQQTTALPT 476
               |...:..||...|  |.|::       ||.||..:..      |:..||...|
  Fly   609 ---GAGGTPATPLLYP--GIPIILTRPNNNNIGNCKAITT------TITTTTTTTT 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIPK3NP_006862.2 S_TKc 22..280 CDD:214567 82/281 (29%)
PKc_like 27..280 CDD:304357 81/276 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..443 26/146 (18%)
RHIM 419..468 CDD:289491 13/55 (24%)
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000269|PubMed:29681455 450..466 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..518 1/1 (100%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809
TyrKc 129..386 CDD:197581 84/285 (29%)
STKc_MLK 134..389 CDD:270963 82/283 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.