DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIPK3 and Takl1

DIOPT Version :9

Sequence 1:NP_006862.2 Gene:RIPK3 / 11035 HGNCID:10021 Length:518 Species:Homo sapiens
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:335 Identity:87/335 - (25%)
Similarity:152/335 - (45%) Gaps:59/335 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    23 NQELVGKGGFGTVFRAQHRKWGYDVAVKIVN------SKAISREVKAMASLDNEFVLRLEGVIEK 81
            :::.:|.|..|.|.:|..:  ..::||||.:      .|...||:..::.:|:|.|:|:.|    
  Fly    13 SEKFLGAGSGGAVRKATFQ--NQEIAVKIFDFLEETIKKNAEREITHLSEIDHENVIRVIG---- 71

Human    82 VNWDQDPKPALVTKFMENGSLSGLLQ---------SQCPRPWPLLCRLLKEVVLGMFYLHDQNPV 137
             ......|..|:.:::|.|||...|.         .|..| |.|.|      ...:.|||..:..
  Fly    72 -RASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVR-WALQC------AKALAYLHSLDRP 128

Human   138 LLHRDLKPSNVLL-DPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTA 201
            ::|||:||.|:|| :....:|:.||||:|....:::     :..|||.|:|||...::  |.:..
  Fly   129 IVHRDIKPQNMLLYNQHEDLKICDFGLATDMSNNKT-----DMQGTLRYMAPEAIKHL--KYTAK 186

Human   202 SDVYSFGILMWAVLAGR----EVELPTEPSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELM 262
            .|||||||::|.::..:    .:|.|.....:.:|:.:.:      :||.....:...||:|:||
  Fly   187 CDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGE------KLPMEAVRSDCPEGIKQLM 245

Human   263 QLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVSTVKDFLSQLRSSN---RRFSIPESGQGG 324
            :.|....|:.|||.:|......|.::.         .|.:||:..|....   ..:.:..||...
  Fly   246 ECCMDINPEKRPSMKEIEKFLGEQYES---------GTDEDFIKPLDEDTVAVVTYHVDSSGSRI 301

Human   325 TEMDGFRRTI 334
            ..:|.:|..:
  Fly   302 MRVDFWRHQL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIPK3NP_006862.2 S_TKc 22..280 CDD:214567 78/276 (28%)
PKc_like 27..280 CDD:304357 78/272 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..443
RHIM 419..468 CDD:289491
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000269|PubMed:29681455 450..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..518
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 77/273 (28%)
STKc_TAK1 17..274 CDD:270960 79/292 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.