DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RIPK3 and let-23

DIOPT Version :9

Sequence 1:NP_006862.2 Gene:RIPK3 / 11035 HGNCID:10021 Length:518 Species:Homo sapiens
Sequence 2:NP_001300607.1 Gene:let-23 / 174462 WormBaseID:WBGene00002299 Length:1335 Species:Caenorhabditis elegans


Alignment Length:468 Identity:115/468 - (24%)
Similarity:189/468 - (40%) Gaps:126/468 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    15 LVSIEELENQ--ELVGKGGFGTVF-------RAQHRKWGYDVAVKIVNSKAISREVKAMASLDNE 70
            |:...||:.:  :.:|.|.|||||       ||::.|  ..||:|:..:.. |:..:.:....|.
 Worm   889 LIPSSELQTKLDKKLGAGAFGTVFAGIYYPKRAKNVK--IPVAIKVFQTDQ-SQTDEMLEEATNM 950

Human    71 FVLRLEGVIEKVNW-DQDPKPALVTKFMENGSLSGLL----QSQCPRPWPLLCRLLKEVVLGMFY 130
            |.||.:.:::.:.: ..|....:||.:...|:|...|    ::...|...|.|   .::..||.|
 Worm   951 FRLRHDNLLKIIGFCMHDDGLKIVTIYRPLGNLQNFLKLHKENLGAREQVLYC---YQIASGMQY 1012

Human   131 LHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLS----------TFQGGSQSGTGSGEPGGTLGY 185
            |..|.  ::||||...|||:....||::.|||||          |.:.|..:          :.:
 Worm  1013 LEKQR--VVHRDLATRNVLVKKFNHVEITDFGLSKILKHDADSITIKSGKVA----------IKW 1065

Human   186 LAPELFVNVNRKAST-ASDVYSFGILMWAVLAGREVELPTEPSLVYEAVC-----------NRQN 238
            ||.|:|   ::...| ||||::||:..|        |:.|.....|:.:.           ||.:
 Worm  1066 LAIEIF---SKHCYTHASDVWAFGVTCW--------EIITFGQSPYQGMSTDSIHNFLKDGNRLS 1119

Human   239 RPSLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQ---ECLPKTDEVFQMVENNMNAAVST 300
            :|     |....:.     .:||:: ||.::||.||.|:   |...:..:|.|:...|.|..  :
 Worm  1120 QP-----PNCSQDL-----YQELLR-CWMADPKSRPGFEILYERFKEFCKVPQLFLENSNKI--S 1171

Human   301 VKDFLSQLRSSNRRF-----------------SIPESGQGGTEMDGFRRTIENQHSRNDVMVSEW 348
            ..|..::.|....|.                 |:|......|.|..|  ||.:    .|:|    
 Worm  1172 ESDLSAEERFQTERIREMFDGNIDPQMYFDQGSLPSMPSSPTSMATF--TIPH----GDLM---- 1226

Human   349 LNKLNLEEPPSSVPKKCPSLTKRSRAQEE---------QVPQA---WTAGTSSDSMAQPPQTPET 401
                |..:..:|...|.......|.|||:         :|.|:   :||.|:.|  .|...:|..
 Worm  1227 ----NRMQSVNSSRYKTEPFDYGSTAQEDNSYLIPKTKEVQQSAVLYTAVTNED--GQTELSPSN 1285

Human   402 STFRNQMPSPTST 414
            ..:.||..:|:|:
 Worm  1286 GDYYNQPNTPSSS 1298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RIPK3NP_006862.2 S_TKc 22..280 CDD:214567 77/296 (26%)
PKc_like 27..280 CDD:304357 77/289 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..443 18/72 (25%)
RHIM 419..468 CDD:289491
RIP homotypic interaction motif (RHIM). /evidence=ECO:0000269|PubMed:29681455 450..466
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..518
let-23NP_001300607.1 Recep_L_domain 77..205 CDD:279382
Furin-like 229..378 CDD:279142
FU 274..>308 CDD:238021
Recep_L_domain 396..503 CDD:279382
GF_recep_IV 531..652 CDD:291509
FU 532..580 CDD:238021
FU 578..625 CDD:214589
FU 759..806 CDD:214589
PKc_like 885..1164 CDD:304357 82/314 (26%)
TyrKc 898..1153 CDD:197581 77/294 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.