DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VAX1 and lms

DIOPT Version :9

Sequence 1:NP_001106175.1 Gene:VAX1 / 11023 HGNCID:12660 Length:334 Species:Homo sapiens
Sequence 2:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:321 Identity:93/321 - (28%)
Similarity:127/321 - (39%) Gaps:81/321 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    20 RVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAE--------DCNKSKSNSAADPDYCRR 76
            |.|.:.....::..|..||.        .||..||..|.        |..||..:.|:|..    
  Fly    26 RSSTSFEDSVQDESGRGGNC--------LGASRASSPATSSCLDDNMDDGKSDIDLASDDG---- 78

Human    77 ILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSE 141
                            .||..||.||.||:|:|.|:..||.||:|.:|:...:||.||:||.|:|
  Fly    79 ----------------NGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTE 127

Human   142 TQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATG--- 203
            ||:|:||||||||.|:....|       .||.|:....:|          |:..|..|...|   
  Fly   128 TQIKIWFQNRRTKWKRKYTSD-------VETLASHYYAQL----------GIGGLARPMVVGDRL 175

Human   204 -ALGSALRGP----SLPALGAGAAAGSAAAAAAAAPGPAGAASPHPPAVGGAPGPGPAGPGGLHA 263
             .......||    |:...|:|:||..|:|..|.    .....|:..:.|..|.|||:.......
  Fly   176 WLFSQTPTGPTPIQSIMLNGSGSAAPMASATTAT----GSPMRPYATSGGMPPLPGPSVMESARN 236

Human   264 GAPAAGHSL-FSLP----------VPSLLGSVASR---LSSAPLTMAGSLAGNLQELSARY 310
            ...|.|..| |:||          ||:  .|...|   .:::.:..|.||..|...|..:|
  Fly   237 AILARGQPLNFALPFGVAKPPAGGVPA--ASYIPRCKPYATSYVDYAASLPTNESYLQMKY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VAX1NP_001106175.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 5/20 (25%)
COG5576 66..184 CDD:227863 44/117 (38%)
Homeobox 103..157 CDD:365835 30/53 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..263 6/28 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..334
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 27/100 (27%)
Homeobox 89..142 CDD:278475 30/52 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.