powered by:
Protein Alignment RAB35 and Rab19
DIOPT Version :9
Sequence 1: | XP_011536081.1 |
Gene: | RAB35 / 11021 |
HGNCID: | 9774 |
Length: | 276 |
Species: | Homo sapiens |
Sequence 2: | NP_001261575.1 |
Gene: | Rab19 / 38930 |
FlyBaseID: | FBgn0015793 |
Length: | 219 |
Species: | Drosophila melanogaster |
Alignment Length: | 33 |
Identity: | 11/33 - (33%) |
Similarity: | 13/33 - (39%) |
Gaps: | 10/33 - (30%) |
- Green bases have known domain annotations that are detailed below.
Human 134 TASSV----------LRRQRHVLAASAASPCQW 156
|||:| |..||.|....|...||:
Fly 123 TASNVLIILVGNKCDLEEQREVDFEEARQMCQY 155
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RAB35 | XP_011536081.1 |
None |
Rab19 | NP_001261575.1 |
Rab19 |
19..184 |
CDD:133267 |
11/33 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.