DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RCBTB2 and Rcc1

DIOPT Version :9

Sequence 1:XP_016875858.1 Gene:RCBTB2 / 1102 HGNCID:1914 Length:561 Species:Homo sapiens
Sequence 2:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster


Alignment Length:340 Identity:84/340 - (24%)
Similarity:127/340 - (37%) Gaps:74/340 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    72 TVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHN 136
            ||...:.|.|....|.||||  :..:|.:||..:.|...|......|.|.::.|..|:::::|.|
  Fly    39 TVLGNVLVCGNGDVGQLGLG--EDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCN 101

Human   137 AYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTV- 200
            ....||..|:..|........:|..|.:. ::.|..||..|..||.|||||.........|.|: 
  Fly   102 DEGALGRDTSEDGSESKPDLIDLPGKALC-ISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLTID 165

Human   201 -NQPIPRRVTGCLQNKVVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGL---------GNSGN- 254
             |:..|   ...::..|..:||.|....:.:...|:|:..|....||||.         |..|. 
  Fly   166 GNKRTP---IDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKR 227

Human   255 ---QPTPCRVA---------------------------------------------ALQGIR--- 268
               :||...:.                                             ||..|:   
  Fly   228 DLLRPTQLIITRAKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPIKTEL 292

Human   269 --VQRVACGYAHTLVLTDEGQVYAWGANSYGQLGTGN-KSNQSYPTPVTVEKDRIIEIAACHSTH 330
              ::.:|.|..||::||.:.:....|...||:||.|: |.....||.|....::|:.: .|... 
  Fly   293 KDIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLTEKIVSV-GCGEV- 355

Human   331 TSAAKTQGGHVYMWG 345
            .|.|.|..|.:|.||
  Fly   356 CSYAVTIDGKLYSWG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RCBTB2XP_016875858.1 None
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 14/48 (29%)
RCC1 92..141 CDD:278826 12/49 (24%)
RCC1_2 131..158 CDD:290274 11/26 (42%)
RCC1 144..193 CDD:278826 15/51 (29%)
RCC1_2 182..209 CDD:290274 6/26 (23%)
RCC1 363..414 CDD:278826 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143331
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.