DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATF7 and kay

DIOPT Version :9

Sequence 1:NP_001353484.1 Gene:ATF7 / 11016 HGNCID:792 Length:494 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:397 Identity:89/397 - (22%)
Similarity:146/397 - (36%) Gaps:108/397 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   179 TLPSPTSVITQAPPSNRQMGSPTGSLPLVMHLANGQTMPVLPGPPVQMPSVISLARPVSMVPNIP 243
            ||.:|    |..|.:.|.:....|.|     |::.||..|.......:|.|:..|..| :...||
  Fly   246 TLTTP----TLTPTTTRNIEDTLGHL-----LSDTQTDRVAGCAGFAVPKVLPNAIDV-LGMGIP 300

Human   244 -GIPGPPVNSS-------GSISPSGHPIPSEAKMRLKATLTHQVS----------------SING 284
             |:...|:..:       ||.|...:...::.:|..:...|...|                |:||
  Fly   301 TGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNG 365

Human   285 G-----CGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRR-RRTVDEDPD 343
            |     ..::...:|:..:|....|.           |....:||:   ..|||| .|:.:..|:
  Fly   366 GGVNNFSNVLAAVSSSRGSASVGSSN-----------ANTSNTPAR---RGGGRRPNRSTNMTPE 416

Human   344 ERRQRFL--ERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLLAH 406
            |.::|.:  |||:.||:|||::|....:.|.::.|:|..:...:..|:.:|.|...||:.||..|
  Fly   417 EEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLATH 481

Human   407 K--------------DC-----PVTALQKKTQGYLESPKESSEPTGSPAPVIQHSSATAPSNG-- 450
            :              .|     |...|...:.|...|...:.....|....|....||..|.|  
  Fly   482 RATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATLNSTGRS 546

Human   451 ---LSVRSAAEAVATSVLTQMASQRTE-------------------LSMPIQS---HV----IMT 486
               |.::.||.  ..|:|..:..:..:                   :::|..|   ||    |:|
  Fly   547 NSPLDLKPAAN--IDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTILT 609

Human   487 PQSQSAG 493
            |...|:|
  Fly   610 PTGASSG 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATF7NP_001353484.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 345..405 CDD:269835 20/61 (33%)
coiled coil 345..405 CDD:269835 20/61 (33%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 20/60 (33%)
coiled coil 421..480 CDD:269869 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.