DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATF7 and Jra

DIOPT Version :9

Sequence 1:NP_001353484.1 Gene:ATF7 / 11016 HGNCID:792 Length:494 Species:Homo sapiens
Sequence 2:NP_001260844.1 Gene:Jra / 36057 FlyBaseID:FBgn0001291 Length:372 Species:Drosophila melanogaster


Alignment Length:439 Identity:94/439 - (21%)
Similarity:160/439 - (36%) Gaps:123/439 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    96 KKLVAAAGPLDMS------------LPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEKEVT 148
            |..|:||..|.:.            :|.|.  .:.||.|:.:|...|:                 
  Fly     2 KTPVSAAANLSIQNAGSSGATAIQIIPKTE--PVGEEGPMSLDFQSPN----------------- 47

Human   149 PKPVLISTPTPTIVRPGSLPLHLG-------YDPLHPTLPSPTSVITQAPP------SNRQMGSP 200
               :..|||.|. .|||||.|:..       :.||....|..:|.....|.      ||..|.:|
  Fly    48 ---LNTSTPNPN-KRPGSLDLNSKSAKNKRIFAPLVINSPDLSSKTVNTPDLEKILLSNNLMQTP 108

Human   201 TGSLPLVMHLANGQTMPVLPGP-PVQMPSVISLARPV-----SMVPNIPGIPGPPVNSSGSISPS 259
                      ..|:..|...|| .|:.   :...|..     ::..|....|.  .||:.:    
  Fly   109 ----------QPGKVFPTKAGPVTVEQ---LDFGRGFEEALHNLHTNSQAFPS--ANSAAN---- 154

Human   260 GHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPA 324
                 |.|.....|.:|...:.|:||         |.......:...:|:.......:.|.|:| 
  Fly   155 -----SAANNTTAAAMTAVNNGISGG---------TFTYTNMTEGFSVIKDEPVNQASSPTVNP- 204

Human   325 QPTPSTGGRRRRTVDEDPDE--RRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSN 387
                         :|.:..|  :.:|..:|||.|||:||:::...:|.||.:.:.|..:|:.|::
  Fly   205 -------------IDMEAQEKIKLERKRQRNRVAASKCRKRKLERISKLEDRVKVLKGENVDLAS 256

Human   388 EVTLLRNEVAQLKQLLLAHKDCPVTALQKKT-QGYL----------------ESPKESSEPTGSP 435
            .|..|::.||||||.::.|.....|.....| | :|                |:|....:|. .|
  Fly   257 IVKNLKDHVAQLKQQVMEHIAAGCTVPPNSTDQXHLELSAGENDEEDVALETETPSNPEDPE-QP 320

Human   436 APVIQHSSATAPSNGLSVRSAAEAVATSVLTQMASQRTELSMPIQSHVI 484
            .|:...|||:  :..|.:..:|....:...:::..:.::...|:..:::
  Fly   321 MPLEFFSSAS--TGALELEGSASQDISLTNSELLEEESDNEQPLVLYIL 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATF7NP_001353484.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 345..405 CDD:269835 23/59 (39%)
coiled coil 345..405 CDD:269835 23/59 (39%)
JraNP_001260844.1 Jun <76..>144 CDD:281890 16/80 (20%)
bZIP_Jun 214..274 CDD:269844 23/59 (39%)
coiled coil 215..266 CDD:269844 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.