DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATF7 and CrebB

DIOPT Version :9

Sequence 1:NP_001353484.1 Gene:ATF7 / 11016 HGNCID:792 Length:494 Species:Homo sapiens
Sequence 2:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster


Alignment Length:319 Identity:65/319 - (20%)
Similarity:110/319 - (34%) Gaps:77/319 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   122 PVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSLPLHLGYDPLHPTLPSPTSV 186
            |.:...:|..:.|..|.......:......||.:|....|..|.......|.........:|:.|
  Fly    48 PQQQQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQANPSGV 112

Human   187 ITQAPPSNRQMGSPTGSLPL--VMHLA---NGQTMPVLPGPPVQMPSVISLARPVSMVPNIPGIP 246
            |..|..:.:|..:...:..:  |:::|   |...:...||..||:.:.|.        |..|...
  Fly   113 IQTAAGTQQQQQALAAATAMQKVVYVAKPPNSTVIHTTPGNAVQVRNKIP--------PTFPCKI 169

Human   247 GPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQIL--IQ 309
            .|..|:.       ||..|:..:....:..|:                :.:|.||..::|.  |.
  Fly   170 KPEPNTQ-------HPEDSDESLSDDDSQHHR----------------SELTRRPSYNKIFTEIS 211

Human   310 HPDAPSPAQP-------------------------QVSP--------AQPTPSTGGRRRRTVDED 341
            .||....:.|                         |:.|        :..|.::|      :.||
  Fly   212 GPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSG------IAED 270

Human   342 PDERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLK 400
            ...:|:..|::||.||..||:|:|.::..||.:...|.:||..|..|:..|:....|.|
  Fly   271 QTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEELKSLKELYCQTK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATF7NP_001353484.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 345..405 CDD:269835 20/56 (36%)
coiled coil 345..405 CDD:269835 20/56 (36%)
CrebBNP_001334685.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.