DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC27A3 and CG18586

DIOPT Version :9

Sequence 1:NP_077306.3 Gene:SLC27A3 / 11000 HGNCID:10997 Length:683 Species:Homo sapiens
Sequence 2:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster


Alignment Length:424 Identity:97/424 - (22%)
Similarity:163/424 - (38%) Gaps:74/424 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   250 HPAG---ISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARISHL-KILQCQG 310
            ||.|   |.|:|.....:...|    |.....|..|...:.:|||:|.|||..||:. ||:    
  Fly   167 HPRGSVRIQDVLTTPVMQNFQP----LRLKDGIDHTLAILSSSGTSGFPKAVTISNSHKII---- 223

Human   311 FYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQYI 375
             .....::..::.|.:..|...||..:.|...:....:::....|..|.|.....::|:::....
  Fly   224 -VDYMAINNSNIQYTSSTLDWCSGLSMAITSGVFSTTSIIADCDFDPGLFCRAIGKYRISMVLLS 287

Human   376 GELCRYLVNQPPSKAERGHKVRLAV--GSGLRPDTWERFVRRFGPLQVLETYGLTEGNVA---TI 435
            ........|.|..::.....:...:  ||....:...:...|.....:...|||||.|.|   .:
  Fly   288 SSYLAIFANCPEFESADLSSLNYVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSVNL 352

Human   436 NYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIR--DPQGHCMATSPGEPGLLVAPVSQQSPF 498
            |:..:..:||||            ||     |..|:  |.||.  |..|...|.:....||:  :
  Fly   353 NFDEKPNSVGRA------------IR-----GIKIKVIDEQGE--AQEPNVVGEICFHNSQK--W 396

Human   499 LGYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRFHDRTGDTFRWKGENVATTEVAEV 563
            .||...|:  :.:.::|    .:.:.:||||...|..|:|...||..|..:::......:|:..|
  Fly   397 AGYYKNPD--ETRQIQD----SENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENV 455

Human   564 FEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHALDLMQLYTHVSENLPPYARPRFLRLQESL 628
            ...:..:.|..|:|:..|.: |....|:||.:|...|:        ::::..|.|.|.       
  Fly   456 IAEMPNVLEACVFGIWDPVN-GDEAAASLVKKPGTQLE--------AQDVVEYVRKRI------- 504

Human   629 ATTETFKQ---------QKVRMANEGFDPSTLSD 653
              |..|||         |.||..|...:.|.:.:
  Fly   505 --TAKFKQLNGGALIVDQIVRSGNRKTNRSAVKE 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC27A3NP_077306.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..145
hsFATP2a_ACSVL_like 163..673 CDD:213304 97/424 (23%)
CG18586NP_647993.2 CaiC 35..541 CDD:223395 97/424 (23%)
AFD_class_I 55..530 CDD:302604 96/416 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.