DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC27A3 and CG4563

DIOPT Version :9

Sequence 1:NP_077306.3 Gene:SLC27A3 / 11000 HGNCID:10997 Length:683 Species:Homo sapiens
Sequence 2:NP_611913.1 Gene:CG4563 / 37901 FlyBaseID:FBgn0035006 Length:537 Species:Drosophila melanogaster


Alignment Length:449 Identity:102/449 - (22%)
Similarity:160/449 - (35%) Gaps:123/449 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   256 DLLAEVSAE-------VDGPVPGYLS--------------SPQSIT----DTCLYIFTSGTTGLP 295
            |.:.|::.|       :.|.|.|..|              .|.|:.    ...:.:.:|||.|||
  Fly   142 DRIKEITKEWSPKLITLTGKVEGVTSIEDLVKPHPAEKIYVPASLATGGDQIAVVLCSSGTAGLP 206

Human   296 KAARISHLKILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGAT-VVLKSKFSAGQ 359
            ||..:||..|....   .||  ...||:|.:..:..|:|..:.::. :..|.| ::.:..|||..
  Fly   207 KAVALSHRHIASTN---SLC--ISTDVLYTSATIDWMTGFSITVMN-LTCGFTRIISRRTFSAET 265

Human   360 FWEDCQQHRVTVFQYIGELCRYLVNQPPSKAERGHKVRLAVGSG-------------LRPDTWER 411
            ......:::||...........|...|.:.:|:...:::|...|             |.|.|:  
  Fly   266 ALYLVSKYKVTCLAMAPWQAYELFTSPLATSEQLESLKIAFVIGGWISLALLRRAQELLPKTY-- 328

Human   412 FVRRFGPLQVLETYGLTEGNVATINYT-GQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQG 475
                     |:.:||.||..|.|||.. ....:|||       :.|...|:..            
  Fly   329 ---------VMFSYGTTETGVVTINIDHSLECSVGR-------LAPGMRIKIQ------------ 365

Human   476 HCMATSPGEPGLLVAPVSQQSPFL--------GYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVC 532
                   ||.|..:. |:|....|        ||...||.....|       .|.:.|.|||...
  Fly   366 -------GEDGQQLG-VNQTGEVLIDIGLKWEGYLSNPEDTATTL-------QDGWINLGDLGYF 415

Human   533 DDQGFLRFHDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPP 597
            |:...|...||..|..::|.::....|:.::...|..::.|.|.||....:...||  ||:::..
  Fly   416 DEDNNLYLVDRKKDLLKYKSKHYWPNEIEQIIAELPEVEHVCVVGVRDARYGDAAG--ALIIKKE 478

Human   598 HA----------------LDLMQLYTHV--SENLPPYARPRFLRLQESLATTETFKQQK 638
            .|                :|..||...|  .:..|..|..:.:|   ||| .|.|::.|
  Fly   479 GAEIADQKVIDHVAQRVVVDYKQLNAGVIFVDKFPKNANGKVMR---SLA-REVFEKTK 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC27A3NP_077306.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..145
hsFATP2a_ACSVL_like 163..673 CDD:213304 102/449 (23%)
CG4563NP_611913.1 CaiC 21..531 CDD:223395 101/445 (23%)
Firefly_Luc_like 49..521 CDD:213279 95/431 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.