DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAPRE2 and CG15306

DIOPT Version :9

Sequence 1:NP_055083.1 Gene:MAPRE2 / 10982 HGNCID:6891 Length:327 Species:Homo sapiens
Sequence 2:NP_001259403.1 Gene:CG15306 / 31961 FlyBaseID:FBgn0030191 Length:357 Species:Drosophila melanogaster


Alignment Length:301 Identity:84/301 - (27%)
Similarity:132/301 - (43%) Gaps:50/301 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    46 VNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKL 110
            |.|...|:.|  .||.||:.|.|:.:..|...:||||:|||||..|.||:|..|:||:|||.:..
  Fly     9 VTVTHNSLVQ--WSRGDILDWFNETLQCNLINIEQLCTGAAYCNLMHMLYPKLINLKRVKFFSNQ 71

Human   111 EHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKE---YDPVEA 172
            |:||::|||.||.:|.::||.....|..|:||...:|..|..||:.|::.|:...:   ||.:.|
  Fly    72 EYEYVNNFKELQKAFNKVNVSLPAEVNDLIKGHRVENFKFAVWFRHFFNVNHTKDKCAGYDALVA 136

Human   173 RQ------GQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSG 231
            |.      |...:...|.    |.|.|.     ..||...|.:......::......|.:...|.
  Fly   137 RDHQNIGIGSSKLTTKDR----FRLVKV-----KTTAIRGKVATCQATINSSLCTGKANQDEDSQ 192

Human   232 SASKSDKDLETQVIQLNEQVHSLKLALEGVE------KERDFYF----GKLREIELLCQEHGQEN 286
            ...|.|:|...|..|..:.        .|::      :::|..:    ||..:.: .|::.|.:.
  Fly   193 HTDKKDEDSRDQGSQYEDS--------PGMDSQYKDCRDQDSQYEDSHGKDSQYK-DCRDQGSQY 248

Human   287 DDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY 327
            :|  ...||..|         |:...::..:|..|....:|
  Fly   249 ED--SHGMDSQY---------EDSRDQDSQYEDSPGMDSQY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAPRE2NP_055083.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
BIM1 59..313 CDD:227542 77/272 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..240 14/74 (19%)
DCTN1-binding 187..327 26/149 (17%)
APC-binding 259..302 10/52 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..327 3/27 (11%)
CG15306NP_001259403.1 CH 20..103 CDD:278723 39/82 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158825
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.