DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB32 and Rab32

DIOPT Version :9

Sequence 1:NP_006825.1 Gene:RAB32 / 10981 HGNCID:9772 Length:225 Species:Homo sapiens
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:227 Identity:146/227 - (64%)
Similarity:171/227 - (75%) Gaps:9/227 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     7 GDPGLGAAAAPA-----PETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKV 66
            ||..:.....||     .:.||||:|:|||||||.||||.|||||||.|||:|||||||||||||
  Fly   460 GDLTMDQEMEPAIMTSTSDKREHLYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKV 524

Human    67 LNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLP 131
            |.||:.|:|||||||||||||||||||||||||||||:|||::||.||:.|.|||.||||||.||
  Fly   525 LQWDANTIVRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLP 589

Human   132 NGSPIPAVLLANKCDQNKDS-SQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVN 195
            :|||||.:||||||||.|.. ...|.::|::.:|:|||||||||||:||||:||||.||.|||:|
  Fly   590 DGSPIPCILLANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILIN 654

Human   196 HQSFPNEENDVDKIKL---DQETLRAENKSQC 224
            .:....:..|.||..|   |.....|:||..|
  Fly   655 DKLISADLADGDKFNLSAADATGSDAKNKCSC 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB32NP_006825.1 Rab32_Rab38 26..224 CDD:206692 137/201 (68%)
Effector region. /evidence=ECO:0000250 54..62 7/7 (100%)
PKA-RII subunit binding domain 178..197 14/18 (78%)
Rab32NP_525109.1 Rab32_Rab38 484..686 CDD:206692 137/201 (68%)
RAB 484..652 CDD:197555 126/167 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 267 1.000 Domainoid score I1883
eggNOG 1 0.900 - - E1_KOG4423
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38233
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001263
OrthoInspector 1 1.000 - - oto90977
orthoMCL 1 0.900 - - OOG6_103102
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3110
SonicParanoid 1 1.000 - - X1523
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.