DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMED10 and eca

DIOPT Version :10

Sequence 1:NP_006818.3 Gene:TMED10 / 10972 HGNCID:16998 Length:219 Species:Homo sapiens
Sequence 2:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster


Alignment Length:212 Identity:70/212 - (33%)
Similarity:115/212 - (54%) Gaps:12/212 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    16 LALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEI---SDQSGG----AGGLRSH 73
            |||:|..|   .....:.||:....|||..||:..:..|...|::   ..:|.|    :.|:..|
  Fly     8 LALILCVL---HSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMH 69

Human    74 LKITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPD-QL-VILDMKHGVEAKNYE 136
            :::.||...|:.|:..:::|:.:||:.......:|..|..|..... || |.||::.|..|.:|.
  Fly    70 VEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYA 134

Human   137 EIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLA 201
            .:|:.|||..|::.:|:|.|..|.|..:..|.:.|||..|.|:||||:|||::|:.....|:.:.
  Fly   135 HVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMG 199

Human   202 TWQVFYLRRFFKAKKLI 218
            .||:.:|:.||:||||:
  Fly   200 FWQMRHLKSFFEAKKLV 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TMED10NP_006818.3 Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 1..142 37/134 (28%)
EMP24_GP25L 31..213 CDD:426051 60/190 (32%)
Required for TMED10 and TMED2 cis-Golgi network localization 147..178 11/30 (37%)
Interaction with COPG1 204..219 8/15 (53%)
Interaction with ARF1 and IL1B. /evidence=ECO:0000269|PubMed:11726511, ECO:0000269|PubMed:32272059 207..219 7/12 (58%)
COPI vesicle coat-binding 211..219 6/8 (75%)