DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMED10 and p24-1

DIOPT Version :10

Sequence 1:NP_006818.3 Gene:TMED10 / 10972 HGNCID:16998 Length:219 Species:Homo sapiens
Sequence 2:NP_572754.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster


Alignment Length:215 Identity:56/215 - (26%)
Similarity:95/215 - (44%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    14 FPLALLLLFLLGPRLVLAI--SFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGG-LRSHLK 75
            |.:||::      ..:.|:  :|.|..|:..|..|||.|:......:::|     ||| |...:.
  Fly     8 FAVALMM------HCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVS-----AGGQLDVDVT 61

Human    76 ITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVE--AKNYEEI 138
            :.|..|.::||.|.||.....|..|...::..||.::.:. ...::|.:|.:.|.|  ....:|.
  Fly    62 LKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSA-FSHKIVYVDFQVGEEPALPGVDEH 125

Human   139 AKVEKLKPLEVELRRLEDLSESI---VNDF----AYMKKREEEMRDTNESTNTRVLYFSIFSMFC 196
            |.|         |.::|..|::|   :||.    .:.:.||.:.|...|..|.||:.:|......
  Fly   126 ATV---------LTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAA 181

Human   197 LIGLATWQVFYLRRFFKAKK 216
            :|.:...|:..||.||..:|
  Fly   182 VIVIGLVQIMVLRNFFTDRK 201

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TMED10NP_006818.3 Required for interaction with STX17. /evidence=ECO:0000269|PubMed:21545355 1..142 34/132 (26%)
EMP24_GP25L 31..213 CDD:426051 51/193 (26%)
Required for TMED10 and TMED2 cis-Golgi network localization 147..178 9/37 (24%)
Interaction with COPG1 204..219 6/13 (46%)
Interaction with ARF1 and IL1B. /evidence=ECO:0000269|PubMed:11726511, ECO:0000269|PubMed:32272059 207..219 5/10 (50%)
COPI vesicle coat-binding 211..219 3/6 (50%)