DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YWHAQ and 14-3-3zeta

DIOPT Version :9

Sequence 1:NP_006817.1 Gene:YWHAQ / 10971 HGNCID:12854 Length:245 Species:Homo sapiens
Sequence 2:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster


Alignment Length:245 Identity:189/245 - (77%)
Similarity:213/245 - (86%) Gaps:0/245 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSI 65
            ::|.||:||||||||:|||||||..||:|||.|.|||||||||||||||||||.|||:|||||||
  Fly     4 VDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSI 68

Human    66 EQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLA 130
            ||||:.|.:|.||.::|||:||.|||.||..||.|||||||..|:|||||||||||||||:||||
  Fly    69 EQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLA 133

Human   131 EVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTA 195
            |||.||.|...:|:||.|||:||||||.:||||||||||||||||||||||||:|:.||.|||.|
  Fly   134 EVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQA 198

Human   196 FDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN 245
            ||:|||||||||||||||||||||||||||||||||:.|:|.:..||.:|
  Fly   199 FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YWHAQNP_006817.1 14-3-3_theta 1..234 CDD:206759 184/232 (79%)
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 182/228 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159672
Domainoid 1 1.000 363 1.000 Domainoid score I947
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR18860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.