DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB40B and Rab8

DIOPT Version :10

Sequence 1:NP_006813.1 Gene:RAB40B / 10966 HGNCID:18284 Length:278 Species:Homo sapiens
Sequence 2:NP_524172.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster


Alignment Length:164 Identity:74/164 - (45%)
Similarity:102/164 - (62%) Gaps:1/164 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     9 RAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLWDTSGQ 73
            :.||:|.|.||:|||.|||..||....:.|..:.:....|||:|..||.||.:::|||:|||:||
  Fly     3 KTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQ 67

Human    74 GRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPG-VPKILVGNRLHLAFKRQVP 137
            .||.||..:|.|||.|::|||||....||:.|..||:.|:|:|.. |.|:|:||:..|..||||.
  Fly    68 ERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVS 132

Human   138 TEQAQAYAERLGVTFFEVSPLCNFNITESFTELA 171
            .|:.:..|...|:.|.|.|...:.|:.|:|..||
  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB40BNP_006813.1 Rab40 9..278 CDD:133321 74/164 (45%)
Switch-I. /evidence=ECO:0000255|PROSITE-ProRule:PRU00753 41..49 0/7 (0%)
Switch-II. /evidence=ECO:0000255|PROSITE-ProRule:PRU00753 72..88 9/15 (60%)
SOCS_Rab40 187..229 CDD:239711
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..278
Rab8NP_524172.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 73/161 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.