DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ERP29 and wbl

DIOPT Version :9

Sequence 1:NP_006808.1 Gene:ERP29 / 10961 HGNCID:13799 Length:261 Species:Homo sapiens
Sequence 2:NP_001286609.1 Gene:wbl / 37206 FlyBaseID:FBgn0004003 Length:257 Species:Drosophila melanogaster


Alignment Length:257 Identity:81/257 - (31%)
Similarity:137/257 - (53%) Gaps:16/257 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    18 LLGFLLLSAPHG---GSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAEN 79
            :|..|||.|.|.   ...:...|.:.||.::|.|.:.:..:.:||||..||||||.:.|...:::
  Fly     4 ILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKS 68

Human    80 S-ASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFR-DGDFENPVPYTGAVKVGAIQ 142
            : .::.|||:|.||:.|||:..|..|.::||:|.:::|..:||: :.|....:|....|.:..::
  Fly    69 AHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLK 133

Human   143 RWLKGQ-GVYLGMPGCLPVYDALAGEFIRASGVEARQAL--LKQGQDNLSSVKETQKKWAEQYLK 204
            .::... .:|:|..||:..::.:...:......|..:.:  |:..|:.|:..::.|.  |..||.
  Fly   134 AFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQN--ARAYLI 196

Human   205 IMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQ-----KKGAEKEEL 261
            .|.||.:.|.||...|..|:.|| :..|:::.|||||.:.||||..|:     |...|||||
  Fly   197 YMRKIHEVGYDFLEEETKRLLRL-KAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ERP29NP_006808.1 PDI_a_ERp29_N 36..149 CDD:239305 36/115 (31%)
ERp29 156..251 CDD:311614 30/96 (31%)
ER retrieval sequence 258..261 2/2 (100%)
wblNP_001286609.1 ERp29_N 22..147 CDD:254509 38/124 (31%)
ERp29 149..242 CDD:285048 29/95 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141561
Domainoid 1 1.000 76 1.000 Domainoid score I9012
eggNOG 1 0.900 - - E1_28K2V
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4963
Inparanoid 1 1.050 117 1.000 Inparanoid score I4811
Isobase 1 0.950 - 0 Normalized mean entropy S7243
OMA 1 1.010 - - QHG59606
OrthoDB 1 1.010 - - D1535651at2759
OrthoFinder 1 1.000 - - FOG0012441
OrthoInspector 1 1.000 - - oto90636
orthoMCL 1 0.900 - - OOG6_109017
Panther 1 1.100 - - LDO PTHR12211
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4822
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.