DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDIA5 and CaBP1

DIOPT Version :9

Sequence 1:NP_006801.1 Gene:PDIA5 / 10954 HGNCID:24811 Length:519 Species:Homo sapiens
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:421 Identity:102/421 - (24%)
Similarity:171/421 - (40%) Gaps:92/421 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   130 SIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQK 194
            |:.||.....|            ||.| :..:|.|.:.|::...::.||||||..|:.::|.::|
  Fly    16 SVSAFYSPSDG------------VVEL-TPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKK 67

Human   195 AATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDNYGSTAEDIVEWLKNP 259
            .|..|:|...:..:|..:.  ..:..::.|||||||..|            |:..:...::  |.
  Fly    68 LAKALKGVVKVGSVNADAD--STLSGQFGVRGFPTIKIF------------GANKKSPTDY--NG 116

Human   260 QPPQPQVPETPWAD----------------EGGS-------VYHLTDEDFDQFVKEHSSV-LVMF 300
            |.....:.|...|:                .|||       |..||:::||:.|.....: ||.|
  Fly   117 QRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEF 181

Human   301 HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKNGEKYA 365
            .||||||||.:.||:.|||:.|.|:..    |.|:|||.:::.|..:::..:||:|:|..|.|.|
  Fly   182 FAPWCGHCKNLAPEWAKAAKELKGKVK----LGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRA 242

Human   366 VPVL-----RTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVMFYAPW 425
            ....     ||....:.|..:......|.|       .::.::.::..||..:.|...|:...|.
  Fly   243 SDAQEYDGGRTASDIVSWASDKHVANVPAP-------ELIEIINESTFETACEGKPLCVVSVLPH 300

Human   426 CPHC-----KKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQQEAVK----GYPTFHYYHY 481
            ...|     .|.:.......:.||..:.....|     :..|.|..:|:::    |||.....::
  Fly   301 ILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWA-----EGGQQLALEESLEVGGFGYPAMAVVNF 360

Human   482 GK-----FAEKYDSDRTELGFTNYIRALREG 507
            .|     ....:..|    |...::|.:..|
  Fly   361 KKMKFSVLKGSFSKD----GINEFLRDISYG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDIA5NP_006801.1 PDI_b_PDIR_N 28..139 CDD:239365 3/8 (38%)
PDI_a_PDIR 152..256 CDD:239295 28/103 (27%)
PTZ00102 168..512 CDD:240266 93/383 (24%)
PDI_a_PDIR 277..379 CDD:239295 40/114 (35%)
PDI_a_PDIR 398..501 CDD:239295 19/116 (16%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 516..519
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 31/121 (26%)
PDI_a_P5 157..262 CDD:239299 40/108 (37%)
Thioredoxin_6 190..383 CDD:290560 45/212 (21%)
P5_C 271..400 CDD:239281 22/133 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.