| Sequence 1: | NP_006800.2 | Gene: | TOMM34 / 10953 | HGNCID: | 15746 | Length: | 309 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001368980.1 | Gene: | CG1847 / 32144 | FlyBaseID: | FBgn0030345 | Length: | 390 | Species: | Drosophila melanogaster |
| Alignment Length: | 252 | Identity: | 53/252 - (21%) |
|---|---|---|---|
| Similarity: | 94/252 - (37%) | Gaps: | 72/252 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Human 86 KPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLV 150
Human 151 PVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEK 215
Human 216 YSESL------------------LCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVK 262
Human 263 AFYRRAQAH-------KALKDYKSSF---ADISNLLQIEPRNGPAQKLRQEVKQNLH 309 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TOMM34 | NP_006800.2 | TPR 1 | 9..42 | ||
| TPR repeat | 9..37 | CDD:276809 | |||
| PLN03088 | <12..>294 | CDD:330826 | 50/235 (21%) | ||
| TPR repeat | 50..80 | CDD:276809 | |||
| TPR 2 | 51..84 | ||||
| TPR repeat | 85..113 | CDD:276809 | 7/26 (27%) | ||
| TPR 3 | 86..118 | 9/31 (29%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..189 | 4/27 (15%) | |||
| TPR 4 | 193..226 | 8/50 (16%) | |||
| TPR repeat | 193..221 | CDD:276809 | 8/45 (18%) | ||
| TPR repeat | 226..256 | CDD:276809 | 7/29 (24%) | ||
| TPR 5 | 227..260 | 9/32 (28%) | |||
| TPR repeat | 261..289 | CDD:276809 | 11/37 (30%) | ||
| TPR 6 | 262..294 | 11/41 (27%) | |||
| CG1847 | NP_001368980.1 | FKBP_C | 23..>92 | CDD:395196 | |
| 3a0801s09 | 150..>308 | CDD:273380 | 38/181 (21%) | ||
| TPR repeat | 173..217 | CDD:276809 | 8/43 (19%) | ||
| TPR repeat | 222..252 | CDD:276809 | 7/29 (24%) | ||
| TPR repeat | 257..285 | CDD:276809 | 10/27 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1535 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||