DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX1 and HP6

DIOPT Version :9

Sequence 1:NP_001120700.1 Gene:CBX1 / 10951 HGNCID:1551 Length:185 Species:Homo sapiens
Sequence 2:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster


Alignment Length:84 Identity:43/84 - (51%)
Similarity:57/84 - (67%) Gaps:6/84 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   100 PKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFY 164
            |.|::      .||..||||.||:||.:.||:|.|||:||..|||.||||:..||:|||:|||||
  Fly    13 PVKQR------NGFDLGLEPLRILGACNWSGKLTFLMQWKGCDEAGLVPAEVLNVRCPQMVISFY 71

Human   165 EERLTWHSYPSEDDDKKDD 183
            |||:.:.....|:|.:.|:
  Fly    72 EERIVFTDEGDEEDLESDN 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX1NP_001120700.1 CD_HP1beta_Cbx1 20..69 CDD:349297
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 10/23 (43%)
CSD_HP1beta_Cbx1 112..169 CDD:349301 38/56 (68%)
HP6NP_608842.1 Chromo_shadow 25..76 CDD:279701 34/50 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.