DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP3M2 and cm

DIOPT Version :9

Sequence 1:NP_001127768.1 Gene:AP3M2 / 10947 HGNCID:570 Length:418 Species:Homo sapiens
Sequence 2:NP_001259302.1 Gene:cm / 31647 FlyBaseID:FBgn0000330 Length:415 Species:Drosophila melanogaster


Alignment Length:417 Identity:291/417 - (69%)
Similarity:357/417 - (85%) Gaps:3/417 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIF 65
            ||||||::||.|::||||||:||||||||:||.:||..|  ..:|||||.|||:||::|.|..:.
  Fly     1 MIHSLFIVNSGGEVFLEKHWRSVVSRSVCEYFLDAQRAA--PYDVPPVIATPHYYLITVQRDTVS 63

Human    66 FVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNIL 130
            .||..:.|||||||||||||||||||||||.|||.|||||.|||||:|:||||||||||||||||
  Fly    64 LVAACKQEVPPLFVIEFLHRVVDTFQDYFGDCSESVIKDNYVVVYELLDEMLDNGFPLATESNIL 128

Human   131 KELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSG 195
            |||||||.||||:.||:||.:||...||:||||.|.|||:||:|||||||||||||:||||||||
  Fly   129 KELIKPPNILRTIANTVTGKSNVSTTLPSGQLSAVRWRRSGVRYTNNEAYFDVIEEVDAIIDKSG 193

Human   196 STITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLL 260
            ||:.|||||.||.|:||:||||||||||||||.||||||||||:||||:||:||||||||||||:
  Fly   194 STVFAEIQGHIDCCIKLSGMPDLTLSFMNPRLFDDVSFHPCVRYKRWEAERLLSFIPPDGNFRLM 258

Human   261 SYHVSAQNLVAIPVYVKHNISFRDSSSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTP 325
            |||:|:|::||||:|::||.|.: :...||.::|:||:.|:|:|::.|.:...||:.|||..|||
  Fly   259 SYHISSQSVVAIPIYIRHNFSIK-TGEQGRLDLTIGPRNTLGRTVDKVKLELTMPRCVLNCLLTP 322

Human   326 SQGTHTFDPVTKMLSWDVGKINPQKLPSLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVN 390
            :||.:|||.|||.||||||:|:..|||:::|::|:..|.:..|.||::|:||:|.|||:||||||
  Fly   323 NQGKYTFDSVTKTLSWDVGRIDVSKLPNIRGSVSITPGTTNIDANPSVNVQFQISQLAVSGLKVN 387

Human   391 RLDMYGEKYKPFKGIKYMTKAGKFQVR 417
            ||||||||||||||:||:|||||||||
  Fly   388 RLDMYGEKYKPFKGVKYLTKAGKFQVR 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP3M2NP_001127768.1 AP3_Mu_N 3..141 CDD:341441 101/137 (74%)
AP-3_Mu3B_Cterm 165..418 CDD:211372 173/253 (68%)
cmNP_001259302.1 AP_MHD_Cterm 163..414 CDD:299401 171/251 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158702
Domainoid 1 1.000 380 1.000 Domainoid score I848
eggNOG 1 0.900 - - E1_KOG2740
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4950
Inparanoid 1 1.050 621 1.000 Inparanoid score I882
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53686
OrthoDB 1 1.010 - - D431751at33208
OrthoFinder 1 1.000 - - FOG0003640
OrthoInspector 1 1.000 - - otm42188
orthoMCL 1 0.900 - - OOG6_102811
Panther 1 1.100 - - O PTHR10529
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5012
SonicParanoid 1 1.000 - - X2508
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.