Sequence 1: | NP_006784.1 | Gene: | PRDX3 / 10935 | HGNCID: | 9354 | Length: | 256 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523683.1 | Gene: | Prx2540-2 / 36098 | FlyBaseID: | FBgn0033518 | Length: | 220 | Species: | Drosophila melanogaster |
Alignment Length: | 212 | Identity: | 62/212 - (29%) |
---|---|---|---|
Similarity: | 97/212 - (45%) | Gaps: | 33/212 - (15%) |
- Green bases have known domain annotations that are detailed below.
Human 67 QHAPYFKGTAVVNGEFKDLSLDDFKG-KYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVV 130
Human 131 AVSVDSHFSHLAWIN--------TPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGS------GL 181
Human 182 ALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVC-PANWTPDS-----PTI 240
Human 241 KPSPAAS--KEYFQKVN 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PRDX3 | NP_006784.1 | PRX_Typ2cys | 65..236 | CDD:239313 | 55/184 (30%) |
Prx2540-2 | NP_523683.1 | AhpC | 1..194 | CDD:223527 | 58/198 (29%) |
PRX_1cys | 3..218 | CDD:239314 | 62/212 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0450 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100111 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.710 |