DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MORF4L1 and msl-3

DIOPT Version :9

Sequence 1:NP_996670.1 Gene:MORF4L1 / 10933 HGNCID:16989 Length:362 Species:Homo sapiens
Sequence 2:NP_523951.1 Gene:msl-3 / 38779 FlyBaseID:FBgn0002775 Length:512 Species:Drosophila melanogaster


Alignment Length:539 Identity:106/539 - (19%)
Similarity:168/539 - (31%) Gaps:240/539 - (44%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAPKQDPKPKFQEGERVLCFH-----GPLLYEAKCVKVAIKDKQ-----VKYFIHYSGWNKKSAV 55
            |...:|..|.|.:||.|||:.     ..:||.:|.:.|..:..:     .:|.||:.||      
  Fly     1 MTELRDETPLFHKGEIVLCYEPDKSKARVLYTSKVLNVFERRNEHGLRFYEYKIHFQGW------ 59

Human    56 RPRRSEKSLKTHEDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQ 120
            ||                                 |:|..|..:.:||..:.|.|.||||.:|  
  Fly    60 RP---------------------------------SYDRCVRATVLLKDTEENRQLQRELAEA-- 89

Human   121 EQYAEGKMRG-----AAP----GKKTSGLQQKNVE-----------VKTKKNKQKTP---GN--- 159
               |:.::||     ..|    .||..|.:..:||           ::.:.....||   ||   
  Fly    90 ---AKLQIRGDYSYKGTPDKPSAKKKRGGKAAHVEEPIVVPMDTGHLEAEHEMAPTPRAAGNRTR 151

Human   160 -GDGGSTSETPQPP----RKKRARVDPTVENEETFMNRV--------------EVKVKIPEELKP 205
             ..||...|  :||    |.|..|...|    |||.|..              .:.:::.|.|:.
  Fly   152 DNSGGKRKE--KPPSGDGRLKGNRGRQT----ETFYNNAINDVSVYNHVPQEDRIMMRVSERLRE 210

Human   206 WLVDDWDLITRQKQLFYLPAKKNVDSILEDY------------------ANYKKSRGNTDNKEY- 251
            .:..|.::|....:...|||:..:.:|:|::                  |...:||.....:|| 
  Fly   211 LIEYDRNMIKVLGKQHALPARVPIVTIMENFVKQQAVELAISIKQDSSRARNTQSRNARMEREYD 275

Human   252 -------AVNEVVAGIKEYFNVMLGTQLLYKFER------------------------------- 278
                   .:.|||.|::.||...:...|||..|:                               
  Fly   276 RVMSTVCMLKEVVDGLRIYFEFHVDDHLLYTEEKEYVHNYLTDDNMRNCSLILNKSYEYINPSGD 340

Human   279 -----------------------------PQYAE------------------------------- 283
                                         |:|.:                               
  Fly   341 TELIGLDGTPVVEGSGDTNGQIGVINIGGPEYEKQLQKCLLYIVTASGKNTAQAYERTSPYTAAY 405

Human   284 -----------------ILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLH 331
                             :|:.......|.|:|||||:||.:::...|..:|:..|.|..||.:|.
  Fly   406 KLPVEMRGFLNETFKWRLLSAESPPEKSMVFGAPHLVRLMIKMPMFLNASPISNKKLEDLLPHLD 470

Human   332 DFLKYLAKNSATLFSASDY 350
            .|:.|| :|....|...::
  Fly   471 AFINYL-ENHREWFDRENF 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MORF4L1NP_996670.1 CBD_MSL3_like 15..110 CDD:350846 21/104 (20%)
Interaction with KAT8. /evidence=ECO:0000269|PubMed:12397079 26..62 10/40 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..182 25/99 (25%)
Sufficient for interaction with SIN3A. /evidence=ECO:0000269|PubMed:12391155 133..266 43/198 (22%)
Nuclear localization signal. /evidence=ECO:0000255 135..146 3/10 (30%)
Interaction with RB1-1 164..230 18/83 (22%)
MRG 184..351 CDD:399022 52/315 (17%)
Sufficient for interaction with PHF12. /evidence=ECO:0000269|PubMed:12391155 188..342 50/301 (17%)
Interaction with RB1-2 323..344 8/20 (40%)
msl-3NP_523951.1 MRG 196..486 CDD:283390 48/290 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.