DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SRSF8 and CG10466

DIOPT Version :9

Sequence 1:NP_115285.1 Gene:SRSF8 / 10929 HGNCID:16988 Length:282 Species:Homo sapiens
Sequence 2:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:76 Identity:24/76 - (31%)
Similarity:38/76 - (50%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    18 VDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQDAEAAMDGAELDG 82
            |....|..:...|..||.:||.|.::.:.|:..|...:||.|:.:.|:|....|...::|.::..
  Fly    38 VAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILD 102

Human    83 RELRV-QVARY 92
            |.||| .||.|
  Fly   103 RTLRVDHVADY 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SRSF8NP_115285.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 21/70 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..282 1/2 (50%)
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 23/74 (31%)
RRM <36..>126 CDD:223796 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.