DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASTK and CG31643

DIOPT Version :9

Sequence 1:NP_006703.1 Gene:FASTK / 10922 HGNCID:24676 Length:549 Species:Homo sapiens
Sequence 2:NP_001285652.1 Gene:CG31643 / 318867 FlyBaseID:FBgn0051643 Length:899 Species:Drosophila melanogaster


Alignment Length:573 Identity:134/573 - (23%)
Similarity:207/573 - (36%) Gaps:191/573 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    77 PSAGPVQGLQRLLEQAKSPGELL----RWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQV 137
            |.|.|:| ..:.|.|.|   |||    .|...|.|   .|.:|| ||.|                
  Fly   356 PFATPLQ-RDQYLHQFK---ELLYSEEAWQQPNAS---GHLFSV-LRAL---------------- 396

Human   138 TLQDL-------SQLI--IRNCPSFDIHTIHVCLHLAVLLGFPSD-GPLVCALEQERRL------ 186
            .:.|:       |.::  :.:||...:| :....|....:.|.:: |.....||.||:|      
  Fly   397 KVSDIEFCNTYWSGVVKELESCPEKHLH-LRFLRHCQRYMNFNNNLGGTYRHLELERKLSRMCMN 460

Human   187 --------RLPPKPPPPLQPLLRGGQGLEAALSCPRF---------------------------- 215
                    |||.|.......:|..||...|....|.|                            
  Fly   461 AIEHDIAGRLPAKFARLASFVLAYGQTPLAWKKFPNFLLSKMLAMAPQLGIQDCFLLSRGMQIAS 525

Human   216 -LRYPRQHL-------ISSL--------------AEARP---EELTPHVMVL------------- 242
             ||: ||||       :|::              ||..|   .||:..|..|             
  Fly   526 ELRF-RQHLPALAGMQLSTMDSILIGCAERHLRDAEKDPLNASELSMIVRTLSHRKKLKNTVVYN 589

Human   243 --LAQHLARH-------RLRE------------PQLLEAIAHFLVVQETQLSSKVVQKLVLPFGR 286
              |||:...|       .:|:            |:|||::..::..|...:|...|:|::.....
  Fly   590 QALAQYKNLHCNDLNSRVVRDMAYNFNASNFFVPELLESMFAYISEQHDHVSGDTVEKVLTCSYN 654

Human   287 LNYLPLEQQFMPCLERILAREAG-VAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGT-- 348
            |.|:|...:.:.....:|.|:.. ::.|:.|...::||..:.:|.:.::.||...||..|...  
  Fly   655 LGYMPASVEALNHASEVLLRDFDQMSGLSVVQACLALCFYKSIPEQLINQVFCVKFIQRIEDEIQ 719

Human   349 ---PHALIVRRYLSL---LDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDI--- 404
               ..|....|.|:|   |:..|.|:.|         ...||.|.|..|    ..:.|.|.:   
  Fly   720 VCYSKATYPERVLNLVMQLNRTVCLDFP---------EANVPWFQQNYI----EAQISKKSLIPS 771

Human   405 -----VAEGLRQLLGEEK-YRQDLTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQ 463
                 |.:.|.|||..:| :|.:.|.|.||..||::...        |.::| :|.||       
  Fly   772 ESTTEVKQLLHQLLQNDKHFRCNHTTPYGYQIDFVIHFD--------RDKNP-IPAPP------- 820

Human   464 AASSATTRDPAQRVVLVLRERWHFC-RDGRVLLGSRALRERHLGLMGYQLLPL 515
              ..||..|...:|.::|.:...|| .|...|.|..:|:.|||.:|||:::.:
  Fly   821 --VEATMLDRITKVAILLLKLDSFCENDLTALRGPESLKMRHLEMMGYKVMQI 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASTKNP_006703.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
FAST_1 278..343 CDD:310980 14/65 (22%)
FAST_2 358..443 CDD:312018 26/96 (27%)
RAP 484..536 CDD:214932 12/33 (36%)
CG31643NP_001285652.1 FAST_1 647..713 CDD:284217 15/65 (23%)
FAST_2 736..816 CDD:285557 26/101 (26%)
RAP 834..894 CDD:214932 13/38 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8291
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21228
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.