DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EHMT2 and set-11

DIOPT Version :9

Sequence 1:XP_006715037.1 Gene:EHMT2 / 10919 HGNCID:14129 Length:1274 Species:Homo sapiens
Sequence 2:NP_001364763.1 Gene:set-11 / 185242 WormBaseID:WBGene00018023 Length:278 Species:Caenorhabditis elegans


Alignment Length:265 Identity:90/265 - (33%)
Similarity:135/265 - (50%) Gaps:21/265 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   985 IICRDVARGYENVPIPCVNG----VDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCS 1045
            ::..|:::|.|...:|..:.    :|.. ..|::||.|...:.:.....|:.:....|.|...| 
 Worm    19 VLYEDISQGCERFVVPVYSNPRFFMDSS-LFENFKYTSRIIDVAGQLACRSASPTFMCQCAGQC- 81

Human  1046 SSNCLC--GQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKVRLQLY- 1107
            |:||.|  |...       :|..::....:....:.|||:.|:|...|.|||.|.|....:::: 
 Worm    82 STNCECSSGVFG-------EGGTVENMELLMWDTVRECNEYCNCALWCGNRVAQKGAMYPVEIFA 139

Human  1108 RTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDG-EVYCIDARYYGNI 1171
            |....||||||...|..||||.||.||||.|.||..|.|.::||  :.|.| |...|||:|.||.
 Worm   140 RDPWCGWGVRASVDIAFGTFIGEYAGELIDDEEAMDRHDSTFLF--ETKVGSETLTIDAKYSGNY 202

Human  1172 SRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGS 1236
            :|||||.|.||:....:...:..::...:.||:.:.||.||||..|||:.:|  .:|.|.|.|.|
 Worm   203 TRFINHSCAPNVKVANISWDYDKIQLIHMCFFTDKAIRKGEELTIDYGEAWW--ANKKFPCLCKS 265

Human  1237 EKCKH 1241
            .:|::
 Worm   266 SECRY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EHMT2XP_006715037.1 cond_enzymes <46..>139 CDD:299129
Ank_2 711..798 CDD:289560
ANK <711..762 CDD:295348
ANK 743..862 CDD:238125
ANK repeat 743..772 CDD:293786
Ank_2 779..872 CDD:289560
ANK 806..935 CDD:238125
ANK repeat 807..839 CDD:293786
ANK repeat 841..872 CDD:293786
ANK repeat 881..912 CDD:293786
Ank_5 901..954 CDD:290568
ANK repeat 914..945 CDD:293786
PreSET 987..1086 CDD:128744 22/104 (21%)
SET 1102..1224 CDD:214614 53/123 (43%)
set-11NP_001364763.1 PreSET 21..117 CDD:128744 22/104 (21%)
SET 75..270 CDD:394802 80/206 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161469832
Domainoid 1 1.000 96 1.000 Domainoid score I5047
eggNOG 1 0.900 - - E2759_KOG1082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753093at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm15202
orthoMCL 1 0.900 - - OOG6_105922
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R211
SonicParanoid 1 1.000 - - X1720
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.680

Return to query results.
Submit another query.