DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTNL3 and Dscam1

DIOPT Version :9

Sequence 1:NP_932079.1 Gene:BTNL3 / 10917 HGNCID:1143 Length:466 Species:Homo sapiens
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:191 Identity:42/191 - (21%)
Similarity:71/191 - (37%) Gaps:45/191 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    80 QYRGR----TEFVKDSIAGGRVS--LRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLP 138
            ||.|.    ..::||..|.|...  ||::::...|.|:|.|:..:.....||:.||::......|
  Fly   369 QYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFDPP 433

Human   139 LISIVGYVD-----GGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYD-------- 190
            :|......:     ..:.|.|::.| .|.|...|      :|.....||.|.|.:..        
  Fly   434 VIRQAFQEETMEPGPSVFLKCVAGG-NPTPEISW------ELDGKKIANNDRYQVGQYVTVNGDV 491

Human   191 ---VEISIIVQENAGSILC----SIHLAEQS-----------HEVESKVLI-GETFFQPSP 232
               :.|:.:...:.|...|    .:.:||.|           .::|.|.:: |||.....|
  Fly   492 VSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCP 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTNL3NP_932079.1 Ig_MOG_like 33..132 CDD:319291 17/57 (30%)
SPRY_PRY_C-I_1 289..461 CDD:293968
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653 16/55 (29%)
IGc2 361..413 CDD:197706 13/43 (30%)
I-set 433..527 CDD:254352 19/100 (19%)
IGc2 446..517 CDD:197706 14/77 (18%)
I-set 533..618 CDD:254352 6/20 (30%)
IGc2 544..607 CDD:197706 4/9 (44%)
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.