DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTNL3 and DIP-theta

DIOPT Version :9

Sequence 1:NP_932079.1 Gene:BTNL3 / 10917 HGNCID:1143 Length:466 Species:Homo sapiens
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:358 Identity:70/358 - (19%)
Similarity:120/358 - (33%) Gaps:124/358 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    99 LRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLPLISIVGYVD---------------- 147
            ||::::..||.|.|.|..::.                  |:.|.|||:|                
  Fly   197 LRIRDVKESDKGWYMCQINTD------------------PMKSQVGYLDVVVPPDILDYPTSTDM 243

Human   148 -----GGIQLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYDVEISIIVQENAGSILCS 207
                 ..:.|.|.::| .|.||..|:...|:.:...:.|.|..|:...:.|:.:.:.|.|:.|| 
  Fly   244 VIREGSNVTLKCAATG-SPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLC- 306

Human   208 IHLAEQSHEVESKVLIGETFFQPSPWRLASILLGLLCGALCGVVMGMIIVFFKSKGKIQAELDWR 272
                           |......|:..:..                 |:||.|.....||.:|   
  Fly   307 ---------------IASNGIPPTVSKRV-----------------MLIVHFPPMIWIQNQL--- 336

Human   273 RKHGQAELRDARKHAVEVTLDPET-AHPKLCVSDLKTVT-----HRKAPQEVPHSEKRFTRKSVV 331
              .|.|..::       :||:.:: |:||.....:|..|     .|..|:......|...|.:: 
  Fly   337 --VGAALTQN-------ITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTI- 391

Human   332 ASQGFQAGKHYWEVDVGQNVGWYVGVCRDDVDRGKNNVTLSPNNGYWVLRLTTEHLYFTFNPHFI 396
                       :|||: |:.|.|..|.::.:......:.|     |.:.:.||          ..
  Fly   392 -----------YEVDI-QDFGAYRCVAKNSLGDTDGAIKL-----YHIPQTTT----------MT 429

Human   397 SLPPSTPPTRVGVFL-----DYEGGTISFFNTN 424
            ::.|:.....|.|.|     :...|:....|||
  Fly   430 TMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTN 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTNL3NP_932079.1 Ig_MOG_like 33..132 CDD:319291 7/32 (22%)
SPRY_PRY_C-I_1 289..461 CDD:293968 30/147 (20%)
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 13/50 (26%)
IG_like 137..230 CDD:214653 13/50 (26%)
IG_like 240..324 CDD:214653 19/117 (16%)
IGc2 247..310 CDD:197706 17/79 (22%)
Ig 327..419 CDD:299845 23/116 (20%)
IG_like 343..420 CDD:214653 19/101 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.